SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 590168.Tnap_1335 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  590168.Tnap_1335
Domain Number 1 Region: 18-130
Classification Level Classification E-value
Superfamily Translational machinery components 1.83e-48
Family Ribosomal protein L18 and S11 0.0000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 590168.Tnap_1335
Sequence length 130
Comment (Thermotoga naphthophila RKU 10)
Sequence
MARKRGSSSRKQKKVGFDYGVVHIKSTFNNTIITLTDKDGNTLTWASGGTVGFEGTRKGT
PYAAQLAADKVAREALRMGIKKVDILVKGPGPGREPAIRTLQGAGLEINQIKDVTPIPFN
GCRPKKRRRV
Download sequence
Identical sequences A5IMA9 B1LBL4 D2C3W6
WP_011943800.1.18251 WP_011943800.1.32102 WP_011943800.1.44660 WP_011943800.1.5118 WP_011943800.1.51822 WP_011943800.1.75526 WP_011943800.1.89131 126740.TRQ2_1368 390874.Tpet_1318 590168.Tnap_1335 gi|148270448|ref|YP_001244908.1| gi|281412755|ref|YP_003346834.1| gi|170289157|ref|YP_001739395.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]