SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 590168.Tnap_1420 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  590168.Tnap_1420
Domain Number 1 Region: 13-157
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.25e-36
Family GHMP Kinase, N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 164-259
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.000000000000288
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 590168.Tnap_1420
Sequence length 271
Comment (Thermotoga naphthophila RKU 10)
Sequence
MVENIGNGSAELVSYAKLNLYLDVLGKRSDGYHEIVGLFQTISLHDTLIVEICDRDFHLE
SNVALPPDNTIKRTWDIFRKNTGEEFGLKVTLKKKIPLGSGLGGGSSNAAAILRYLGEVF
KIPLEDLLNIASQVGSDVPFFLYGGTALVRGRGEIVEKLEDIEGYSVDLFFLGIHSSTKE
MYRSLTPEMYRKGPGKVEELHRAYLERDYEKIKELSYNVFEKVFLEKHPEVMNELRNFGD
GSIVKMMTGSGSAFFALYPLDKGNYSFVGGV
Download sequence
Identical sequences D2C448
gi|281412837|ref|YP_003346916.1| 590168.Tnap_1420 WP_012896495.1.51822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]