SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.P11873 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.P11873
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily HMG-box 3.4e-22
Family HMG-box 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.P11873
Sequence length 100
Comment (Tetrahymena thermophila)
Sequence
AKSKDDSKPAPPKRPLSAFFLFKQHNYEQVKKENPNAKITELTSMIAEKWKAVGEKEKKK
YETLQSEAKAKYEKDMQAYEKKYGKPEKQKKIKKNKKGSK
Download sequence
Identical sequences P11873
5911.P11873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]