SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001009857 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001009857
Domain Number 1 Region: 9-102
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000189
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 
Weak hits

Sequence:  5911.XP_001009857
Domain Number - Region: 179-211
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0288
Family Trimerization domain of TRAF 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001009857
Sequence length 215
Comment (Tetrahymena thermophila)
Sequence
MEEAPHLNEDQLNEIYSWVDSIPLSRPKKNIARDFSDGVLMAEVVAHCIPRLVELHNYSA
ANSVKQKYYNWETLNKKVFSKLGLLVCKTDITNIVECKPEVIERVLKLVKNHIEAFNSDP
QNFSPEKSQKSFNQIKRGGALMDRGNNKQRFQNQDNQYQQSQQDEIIWEKDQTISELRET
IEILELKMKKLEDLIKLKDNKIATLQNRMAEHGLY
Download sequence
Identical sequences Q22W05
5911.XP_001009857 XP_001009857.2.55412 3829.m01338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]