SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001013042 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001013042
Domain Number 1 Region: 12-98
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 8.63e-21
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001013042
Sequence length 197
Comment (Tetrahymena thermophila)
Sequence
MLNKQQKQSIWSGSVYEGDMKDGWYHGKGKFKYPNGVIYEGDFVKGQFHGEGILIYPNGG
KYKAHWEHGKMIKGDYYFQDNLKYESEQWNYCQGEDRRFYPEMLNGIKPAGATQMTKEEK
APHDIPEGTYDVGEGYYEPIKSIIYEYDGKILRTPSEAEVENILKKCRYNPRKSLVITGE
NDKIIKSVTDPSKQNKI
Download sequence
Identical sequences Q237E4
XP_001013042.2.55412 5911.XP_001013042 32.m00304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]