SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001014568 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001014568
Domain Number 1 Region: 25-83
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000236
Family RING finger domain, C3HC4 0.0089
Further Details:      
 
Domain Number 2 Region: 90-148
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000628
Family SIAH, seven in absentia homolog 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001014568
Sequence length 151
Comment (Tetrahymena thermophila)
Sequence
MDLNRLSRVFSTKEQQKQIANPDKILEEELKCPICLEVSRKPVTTDCCGSVFCEDCIKNI
VTKKCPKCNKQSFTYSLNIFANRLVNQFPIVCKYGCGHVSGGSEIGNHEKQCPNKILKCK
YCNFEGVYNSFLQHIINQHVNQIVQLFEKQE
Download sequence
Identical sequences Q23DW8
5911.XP_001014568 3824.m02815 XP_001014568.1.55412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]