SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001015042 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5911.XP_001015042
Domain Number - Region: 61-86
Classification Level Classification E-value
Superfamily BSD domain-like 0.0602
Family BSD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001015042
Sequence length 219
Comment (Tetrahymena thermophila)
Sequence
MHRYFRIVQELAEKEVVMNNKSRFQAYISAYNQAKDLKFHHSQIIKKYNLGYIDSLASQY
HQNIILRKNNKLMQEYQEIVKRRVLNRKIEGTTDEIKHFTEDLKSYQSNLFALSEKSFQD
FVDQQMLKLKDKNQLKKYLDPKELILLYQYYHSKINEILLGYVKLYHEAVQNMLEGKREV
MQKEDFRFEDGETVKDKMDKLEEYLKSKMPKFRSNKNIK
Download sequence
Identical sequences Q23DZ0
5911.XP_001015042 101.m00166 XP_001015042.1.55412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]