SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001015860 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001015860
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000106
Family SNARE fusion complex 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001015860
Sequence length 96
Comment (Tetrahymena thermophila)
Sequence
MNMYQQEISEQDKHIDEINYVVDKLKDQQGLMKDGLDEMGQKLQDLEEGIDKNGVRMNAV
QKKLSKLLQTNDTSQICTILILFGILCVLIFLVIYT
Download sequence
Identical sequences I7ME69
XP_001015860.1.55412 3690.m00006 5911.XP_001015860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]