SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001016066 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5911.XP_001016066
Domain Number - Region: 175-217
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0536
Family Delta-sleep-inducing peptide immunoreactive peptide 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001016066
Sequence length 231
Comment (Tetrahymena thermophila)
Sequence
MDLFEIQDYMDPNLLENGTFQYFSKQAQVELRLMQEDMSEKIIGEEKIHIRVFGQSTDKK
NLNWFKIELTSDVDVFFTYIKQFDYNTFQQFKFEEQIQVDFEQFPNNLLNIINSSINQQN
EKIVFLMEIGKPVGNLVFLQDLGHKNMLLLSMQMDLATQEQVKQNIMYRYSKMNKKLIDR
NNKLEQINDYIKIKNPELLNILQKNLNIPQPNNTQNGSRPAQQIIKKNPFH
Download sequence
Identical sequences Q23H26
5911.XP_001016066 XP_001016066.1.55412 156.m00096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]