SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001016448 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5911.XP_001016448
Domain Number - Region: 71-106
Classification Level Classification E-value
Superfamily DEATH domain 0.0259
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001016448
Sequence length 152
Comment (Tetrahymena thermophila)
Sequence
MGCTSAKQHKSTCELKGQIQNELLTKSKRINQIISTVQKLAIKIQNIYATVIIQNNQIPA
DYACLEPVLFLKAIKQNNLLSDDEIEQIVFKFRVIFQKMRILIDEISFILFYDNQNNIIP
KQKKFILFEIIMLYDTTSVKFFEHYKATSIKL
Download sequence
Identical sequences I7LUX0
XP_001016448.1.55412 3699.m00260 5911.XP_001016448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]