SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001017498 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001017498
Domain Number 1 Region: 1787-1885
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000587
Family Calponin-homology domain, CH-domain 0.0063
Further Details:      
 
Domain Number 2 Region: 1588-1880
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000132
Family Calponin-homology domain, CH-domain 0.0063
Further Details:      
 
Weak hits

Sequence:  5911.XP_001017498
Domain Number - Region: 2679-2735
Classification Level Classification E-value
Superfamily PapD-like 0.000741
Family MSP-like 0.043
Further Details:      
 
Domain Number - Region: 2589-2663
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00149
Family Transglutaminase, two C-terminal domains 0.0073
Further Details:      
 
Domain Number - Region: 1285-1367
Classification Level Classification E-value
Superfamily PapD-like 0.0018
Family MSP-like 0.051
Further Details:      
 
Domain Number - Region: 910-1002
Classification Level Classification E-value
Superfamily PapD-like 0.0034
Family MSP-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001017498
Sequence length 3204
Comment (Tetrahymena thermophila)
Sequence
MSTLNIKTEAQRAQSAQVAMVRAQSAKNQRAGLMSAHPKMVGKSQFKKENTKQQMHNNWM
KDDDLSSDDDNMDIFGNHSKVNAKNISRNIRSAQSNARPNTASTAASKLNVKTLKNITNQ
QCFEITPTEIYFDNIEINQPYQTILYVQNLSKIPKKVRVYQPKTKKFWVDFDSSQSLAAG
ICGKLYINFETNVLEDFADEVEIEYEDEGKKQKIVVPIFAKKPHPTIIYQDFINMGFVRI
HRDVQRTLVFENKGKMPGRVRLIFDHIKSIKMEPSVFVIQPQLSQQVKLTYNQKDSGIFR
GQIEVQVDGKQNSGYIDISATCVDYNKMILDENNAQTSSFDFGEIYYGQSKQQIGYLYNN
SPKPQKFKVQMKLGIFNPNDETVSLQTPADQGKEITDQIMSVFPSQGEIKPYSNVQLAFN
CNSVVTFEHQVLARKYALSTNDIQMKAQEYQYSALFKFKDDDPKEEPIVVSLTVKGTYPL
LKLSKQILKFGECNANDHRESLLDLENRHSKLPIDVVVERTPCFNIDPMQISLIPNQRST
VKVSFTPNNVGQFSKDIIFSLLNGLYQIPLKVTGQSQKFDQKKKKERGPECGIEDFQTKD
QYLDAAINKNIYDKKMGVGKRTFQASTEVKLPKGLEGEKDVDINKLAEIQKDKENKKKYD
GVLEQSRQSRIQKEKQKIIDLRYHQMFDKLKAKGLVDQPDDEVSIGPVDNKDQIVRGDPK
IGAPVDLEFELGMMDPKIEPPMLDLPPSKDPLFVLKPIGDYDPIQDQIKKVFDPNPDAII
KKLLPEKAVDHKDVKGVHKELTGQELKCIQSGPTVIDFGEVYVNSRVQKTFSVKNDLRDA
IRVQLKTNVPELRESFQRPQILKSSETARFAIVLFSEDVDEEFKARIQYTINYRHQYEFE
IRAKITQVSLKLNKTQIKFAFQDNNNGMETSETVLVENNGNAPGHFKWDTSSKIFSIYPS
EGDCPAKGNIPITITYRPSPGTSTRETGTRYEEDKLLLYVTNGMNQVLKCVGVVNEAKCV
IKQSSMELNQVLVCKEEVRSFTVKNTSRIAAIYRILTEYLPENLIITSQTSGRIPSDGSI
EVGVKYLCNTECKVESDIKILIRGGKILKLPFSVETIIPKVYIRESAFNFGKITALGNQG
EKEMNLVNESAIEAYLVLDLRTEDENPDAPDGIDCLTIVSLDKLEESILKQVPIDYTDDN
QDKHDQDDEDMSTLSDEDKHDMHNKVSKLYNITIKPQQTLRFKLTFQPKAVRDYEFEIPF
TLQKYGKIDSLTRSVSCKGMKPKFLVDPQVVEFPRKIITSIEHQFPINSEIILSNPEKRS
ISWRLDTSILEKDKIFTIHPTQGRVDPGQTLRIKSSFNPSYPNNYEKLVPLYIDDPDIPA
DQPCCYITLKGVAAYPKLLFDRREVLMPVVPLNVESRCIFYIINDGYDNLKIKHKILEEL
GQIDIKCNFPNGILMGMTHTKLKVEIIFSSKKPISFTTKIEFKDNNSNSYIIPVSGTADN
CLFTNFSFIQRNKGGYAIRSDSEKSALQILEEKDSDGEDDVSVEIQSKGTSNQIQKKRSS
ILSNQTISTRISIPSGQGYTLIPKDMIESSREFIRQWLNYYVLPNQIQSFPETIVDDNGD
QLIELVNFCSGKSISNLKCDLQNGMKRAEKSILLFKQYDEIIRYLKAEGALLNHIRPQYL
LSYNDYHSYIKQLPKEQNSHVAPQYLKIHPKIYQYIHFDCWINLFYQIIKCYYLAKVNSK
IIKNIPNALPEKLTLPDFYINGSNIYSDKEGILIRWLELCSDVVLGNLISGNPGKRIRNL
ETDLQDGNVISYLLQNYVGTSCANLFNFMKPECASEEEVYQNCEKLAAAFQELKIQTQYN
PIDLARPNAREILLFLIQLYSTLPFYIPKQAPLIFSCILGEDIVKTIEITNPTQKPISYW
VKYEGSPDFSLESEDNFRVEPKGVYKYKIKFTSRVSNTQTGRITFTNKKESTTIASAIVF
DLKSQITGRVSQQIWNVECSMYECKEFSIAVQNKFLNHEYGDFMVSIMHEYEIKKPEEKK
EEEPKETKKKKTVSQTFQMSNNKKGKKKQSEEEDPLALPEVEKLNFPCFFCKTERVKLKR
GATFNLQMAFIPIIYENQKCYVIFNDPKVGEFQHEIRGRVDMPEEIIEIPNDKLQISPVI
VDNLTSWNIPLTFNNENLKNARKYLEQWLVEKPKFQKVAINPPTPQLTVKKIYQMLSPRI
LGYDVEIEQPPANAITVPKLIKLLNPHYKAPPAPTPLPQEAQAQSKNDNKLKSQKNAVNK
DNKEKDEKKSQQSNNTEKNKVVSVDQSQSLDSNNMDSQQATSLSNVPAEPETNHLPLNFF
FKNPFKDYISNIVIKNQQKTDVRRFKVVVTALPKAVKATLEMTAPARECVMQEIPIINNT
EKDWQLKINLVQNNEQKYFFINQMPKDGQERPQSLRDFIVKRKTTGNIPVCFFPEWICNV
EATLQIQNPLTQDQFDYSLKGIGEEPLAIDHIIITSQSRVTTQREIMLNNPTEQPITYIV
ETDLLGAAGQASITVPPKKKIPYILQIHPVMSGQYTGSITFTKADGTYIWWTVLLNTESP
PADRIIDLATNIHLSNPTDDVVTFEVVFEGEGLLGDQFFNVYPKQMYKYELFYMPLKPGK
QKGSVAFLSEKLGEIWYELNLQADDSGVVRLPILKCELGKIEQHEVILENPSNEDVKVKV
KISNPQNFEVYPENIVIPSYDQISAYIKYRPSQLDKPQTSEVIFETENIGKWVYTLFGQG
LPPTNFDTKIITIGLNKDYSSVLNFKNPFKDPVQVRIFIDTKDVKVLDVIKLLKRGKENY
VIIPPLTVHQIPFSFTPKEIRFYDCDVVVAMNDKIQWRFPIHAITESLNSGVIQNFKTKC
RVQTNQQFSLNLPGISDMFNKEDKYTFQIKDIPEEFKKLIDRSLKIKITKNTLNSPDDFL
SFDVSFKPYKPFKCIVDFLVLRENGGLWKFKISLEATVPNEDDIIILSAPIGEKDSVSFK
IMNRFKSFATFHSHFTQESDVEFSVTPMTGLLEPAGGKNPTQFIITFTPLEYGKVRQAKL
IIETDEMYWSYVIKGVLPKYIPPQIQESRFNYKPNYSYLQELNRRSTEKKNFISTNIKNQ
SMISPSVKSVKTKFKNTSVSKGYFNYVPSLAGGEGDNQTVVSYVTSNYPNNAQKVFRVQP
AKSVKSVKSIKSITKNESQFSNNN
Download sequence
Identical sequences 5911.XP_001017498 3689.m00010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]