SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001019649 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001019649
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.62e-41
Family Calponin-homology domain, CH-domain 0.0000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001019649
Sequence length 337
Comment (Tetrahymena thermophila)
Sequence
MNEAFGMMDEGYFKPRSEILKFINDLLGLNVTKIESLGQGAVYCQILDAMFPGKVSLQKV
NWKAKLDWEFVNNLKVLQTAFTKLGIKRIIEVEKLSKCKYQDNLEMIQWLMRFYECNCNK
PPGEYDAAAKRKGVEPDFSFADKIVVPKIFNPSMNKPQEEQSEKPKKQVTSSHATTTATN
FHQNNASKKAADSNEQKAPSQKLIDSQQNKGRSSSSNIPPPKALGAKSDTPMEKLDKIKK
IIQKIDASDAEKLAQISKIVGIKNTQALHQETHEEQKINTDQHHEQEIKINQEHEQIVQE
HEHSHNLLHQEDDENLMNNEEEHDLNKNNDHEDEECL
Download sequence
Identical sequences I7LVN4
3698.m00064 5911.XP_001019649 XP_001019649.1.55412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]