SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001019746 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5911.XP_001019746
Domain Number - Region: 6-43
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0723
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001019746
Sequence length 47
Comment (Tetrahymena thermophila)
Sequence
MGVIRTLVLNWCSKNQKEIKLSNIYKKIYFTSGFKFLQLIDKLISVF
Download sequence
Identical sequences 5911.XP_001019746 3698.m00157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]