SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001022426 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001022426
Domain Number 1 Region: 1497-1707
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-28
Family Extended AAA-ATPase domain 0.024
Further Details:      
 
Domain Number 2 Region: 2480-2598,2630-2752
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.13e-19
Family Extended AAA-ATPase domain 0.065
Further Details:      
 
Domain Number 3 Region: 2124-2379
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.5e-18
Family Extended AAA-ATPase domain 0.043
Further Details:      
 
Domain Number 4 Region: 1727-1938
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.03e-17
Family Extended AAA-ATPase domain 0.07
Further Details:      
 
Weak hits

Sequence:  5911.XP_001022426
Domain Number - Region: 3584-3633
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00636
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 
Domain Number - Region: 2991-3031
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0356
Family SNARE fusion complex 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001022426
Sequence length 4198
Comment (Tetrahymena thermophila)
Sequence
MAVNPNIRRQRGIYSEVIDPENAQKIDPKIVQAGPKVEIYKSISVTSLPKAISLQRLQSR
NGLRPNTSSQKLFSDERDILRSRMQSRNEQRKVLRENAKIVSSVNPKVMEPYDPIPGQVP
RKVAIDRKKKQFASYQLEDLMLYLNVDFNQPDTQCEWLPLELFDDSTFDENSSFEWLDRT
KGDEEENDFHPLTGRALFKNSEDNKFYYQKVEITSYTRETNKYKGRKLETFNADDVINFE
LHRIFVCFDAEDPRKYVLRLANAFQQRVYTDSIIRYNFYIDNMPTQDLSELDTEQKKRIA
DLAKTTKIEDLDTTALIADVNMDFSRTMNKIIFDTFLEECQDSEYFPKHLRLPPKEEEKE
VRYYGTMELERTKGIKEMHVTSNREISFHEPKDFNDTFKSFCFASLYIKKEVIKALQEIR
VECNKINDMDIFQLKIDEAMHLDQFKHLQESFTSSLIYQLRGTWIEGMVKIIKTQFADVG
KGWFNMKENERITYDFGKLKKFLTVIRLMMQDTVTSLVQRNYNDYRDMILSFIPSKVIVH
DTSKVENIFPEHVDEKKRTRALFQLDLKTQNDEIFIYSPKNPEVFVNVVLHVFDKALEEL
AKIPDLEPKIASNLYKGQNLETYIKTPQKPREKPVDPDPNARPRKFPDENKWIWEMAELL
KERVGQATEPLADYLKAFDKYIPILKSTPEEYCKAMENEIENPRDIESINDEIAEVERKK
KQLKIDIPEYIHVSCFQISCLEVIAHLDEKLSDLSKNLKTVIAKRAKEGTTNIFNQFTLI
KAKLNEDPTNIEKLVELQEYITNMLPIELEKLKSDMNKVFDVYKIMEDFNYKFTPDEMNK
RWNVFAGPRDILQLINEREGKLDKLKTKFAEEMKEQQDEFKQNYENLEQTIQGFSSYIDI
KNHSDMAKMVMEIHESLLSIQDESRKFNQREHLFGKDMTEYNKLGNMQKEFTPYFNLWKI
VDFWMKGFSKWMYDDFDKVNAEEVDKFVEEGVKTLGGIMRVMKEKELTQIYEIAQKIKAE
MDEFKPKVPLLVALRKQGMEERHWKDISRVMGKTIEKKNEGFTFDQILQMDLMKHVDEIV
QIGERAGKEFQIKTLLDTMETQWEEINFQLLPYKQTSIIRGYDDISIILDEHIVQTQSLL
FSPYKKEFEERIFEWDKQLTTMSDVLEEWAKFQGQWMYLQPIFDSQDIAKQLPAETKKFR
TIDSTWKTSVTQAKHILNVRKVCTEEGLYDKLRESNKNLEIIQKELNNYLEKKREKFARF
YFLSNDELLEILSQTKEPTAVQPHLKKVFENIHKIEFDDQKKIHAMFSAENERVPFEKFV
DPNRKNVEEWMGDVENMMKRSVRRALNNSVEDYNKKPRPKWCISHPGQCVLNGSQVLWTY
EVEEAIKNEGQEDKVGIKGYWDKLKLQLDDLVDLVCTKLTKQQQVTINALIVIDVHAKDV
VQRLINENVKDVSAFEWISQLRYYVENEDVRVKCVQTDFPYGYEYLGNTLRLVITPLTDK
CYMTLMGALKLNLGGAPAGPAGTGKTESTKDLAKALAKQCVVFNCSDSMDYIMVGKFFKG
LASAGAWCCFDEFNRINIEVLSVIAQQLLQLFGAKDKGIGQIEFEGSNIKVLPTFCVFIT
MNPGYAGRTELPDNLKALFRSVAMMVPDYAMIGEIMLYSFGFKLGRELAQKMVVTFKLSS
EQLSSQDHYDYGMRAVRSVINAAGLLKSATPDMDEQQLLLRALRDVNVPKFLKDDIPLFE
NIISDLFPGVERPKYEYGDLVSQISVVCKDPDLNLQPVQAFTDKVRHGLMLVGPTGGGKT
SNYLVLQRSLSNLHDKGFYKVHTHIMNPKSITMGQLYGQFNEQTHEWTDGILAYIIRETV
KDTSSEKHWILFDGPVDAIWIESMNTVLDDNKKLCLNSGQILTLTPHMTMMFEVEDLAVA
SPATVSRCGMVYMEPISLGLQPLIDSWLNSIPANIQKRAKIIERLKLLFDKLLQPCLTFL
RKQCKEIVATGDNNLTQSLQRILNSYFAEYAETEFKRIPSEEIDNLQNMIDQLFIFSLIW
SVMATCDSESREKFSNFYRNLFTTVTDCGFPQEDSVYNYFWNKEKKVFENWQIQYASFEV
SSKYQYHEIMIPTNDSTRNIYMKKLLVSQGYHVMCPGPTGTGKSQNCYSLLTTQLGEEYQ
YIALTFSAQTSANQTQDTIDSKMDKRRKGIFGPPIGKKCIIFVDDLNMPKKETYGAQPPI
ELLRQFLDHQGWYNRRDLVFMRFQDIILLAAMGPPGGGRSNITARCTRHFNILAYPELER
TIINQLFQTLVKHFFKKFDTTIKEAIPQLVESVIEVYYKVKNELLPTPSKSHYTFNMRDI
SKVFQGMCSATTNTKTCSEIPVLIRLWYHENMRVFHDRLTTDQDRQYLKEILQDFFQKFN
ITKEEVLTTQRIIFTDFLQGRVIQQNKQLHILIVKFYITKELEPRIYAPVDDLDQFIDKM
DYFQEEYNTDNTFVINGPRSSMKLVMFLDACEHIARIARIIRQPQGNALLFGVGGSGRQS
LARMATFLSNYKLFQIEVIKNYNMRSWRDDIKKCLMMAGVENKSLTFLFVDTQIINEQML
EDINNILNSGDVTNIYQEKDMEDIQNACKMDCIKKGLQPNKMNIFTQYLIRVKKNVHIVI
AMSPIGEAFATRLRMFPSLVSCSTIDWFTEWPEEALLGVGKGQLVDFEEELKIQGLTTNL
VTIFKDCHKSVEKISQRYFQELRRYNYVTPTSFLELLNLYKSILDQKNKGLNEQISRLKS
GLDKLAGANKAVEEMKVTLTKMRPELEIAQEQTQKMMEYLEVEQKDADETQKIVAKEEIE
AKKQEREALELAEKAEAAVAEANSSLAKTLKNVSELKKEHLVEVKSLQTPPEAVKITLAG
VVILCTDYVKKIGEIIITAVKDQFGKKEENYFQTAKQYLLTDPKELLNILMNYNRENINP
KYIEKLEKVCFPHPKFNEADAYGGSKATGYLFGWVKAMYDFHKVFTDTEPLRKQLDEVKR
VVQQKTEELKEKKESLEKINQKINNLRQQSEEKIRQKEYLTNQIKECEIKLERAQKLTDG
LKDEKERWSSDIEVLSEKGKLYPGDAAIAAAMLAYSGSFVASYRSELEHLWIKYLNDLSI
LHTDNITMRQFLGDEVQIQTWNLCGLPKDGTSIENGILIDKSRRRPLMIDPQNQANKYIK
NLGREVKGDIIVQKVSDPSLMRSIEQALQFGKWVLVEAVGRDLDPSLEPVLNQQLIRQGN
EYLIQFGEKRLNYSPEFRFYMTTNLRNPHYSPETSVKVTIINFAITPFGLEEQMLARVVE
KENPNLENRKNEIVRKNAQDKRDLVATEDQILSSLSSTKGDIADILLDETLINQLQNSKK
FAAEINQRVKDSKKTEIEIDKAREGYRPVAFRTSILFFCILELATIDPMYQYSLQWFINL
FEMGVENAEQSEELEQRLHNLNEYFTYSLYENVCRSLFEKHKLIFSFLLTQRILASKNEI
NLEEWQYLLSGPQGSIHVKQNPTNWIADSSWPDIYKQLYGMNKLPNFQGIEDHFMENPDS
YKDIYDAQNPHEMELPGEWNTKLDEFEKIVFLKFIRSDKCIPAIQNWIKNKIGQEFIIVP
TFDLAKCFKDSTILTPLIFVLSPGSDPVSDFQKFAEENNMTRKVKMISLGQGQGPKAEKL
IVEGKQAGGWILLQNCHLATSWMPELERLCEEFDETMHKDFRLWLTSAPSSTFPSSVLQN
GVKMTIEPPTGLRANLLRSYKNLSDQELSDCKKPNEFKKLLFGFCLFHAIIQDRRKFGAI
GWNIAYEFTNEDLGVCKKQLKLLLDEYNEIPYKVLNYLGAEINYGGRVTDDKDIRLIKSI
LASYCCKDVLRDGHKFSESGLYLSIPASTQEDYIKYIENLPLNPAPEAFGLHDNAEITNA
QNETRDLLESLLSLQPREQGGEGKSREEKITEIANFIQQQTPPVWDIESISKQYPTDYNE
SMNTVLVQELIRYNRLLEIMATSLVQVKKALVGLIVMSEELEILANNLHDNQVPHMWNEK
GHLSLKPLMSWIEDLNQRVNFLNDWIQNGTPKIFWISGFFFPQAFITGSLQNYARRKFVA
IDRLQFEYKVLDIDPSKVKEKPEEGCYVYGIYLEGARWDYKKQVINQPKPKELYSDLPVM
HLLPVVDRQKSDKIVSRRGTLSTTGHSTNFVMFIELPSNKSEDIWVRGGVAAFLALRY
Download sequence
Identical sequences 5911.XP_001022426 3735.m00098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]