SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001030106 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001030106
Domain Number 1 Region: 593-632,708-742,798-818,860-942
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000124
Family Nucleotide and nucleoside kinases 0.094
Further Details:      
 
Domain Number 2 Region: 6-106
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000054
Family Calponin-homology domain, CH-domain 0.007
Further Details:      
 
Weak hits

Sequence:  5911.XP_001030106
Domain Number - Region: 1497-1601
Classification Level Classification E-value
Superfamily EF-hand 0.0389
Family Calmodulin-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001030106
Sequence length 1673
Comment (Tetrahymena thermophila)
Sequence
MGDLIFTWLNDEVQLTKKITSFEQDFANGYYFGELLSKYNQQLNFKEFKNADTRKAKMTN
FDLLQPTFRTLKVKFNSQTVDDIINCRKDVASQILYQLKMALEKVNNPADVIINSKAGKY
NTVTPLMRINPPIAQFANMESKFFNQRLNQLNRSQKAVNQDNHLKKFEEFKIQQDAYIKK
IKESEEEKEKQLKEQMRKIELNKLQRNMAFQEDWNEKGLEQWKKNQEITKQRVEADKQFD
YKQKQKEETKRLQIKELTKNETNRDIDMFEETLKKKGLLLEEDEDGNIIKKEHKNTISAT
ATMKRIKEKSQVNEFLRKERDKRRRKMIVDQAKFQRDIEVRKREELVLKKLEQQSRQEKE
IEYEVWRAYQCKQIIIQDRFLRDEKYKQKNEVNVVNAKYKEEELLKILRQENENDILSKL
NRQREIEISEKQLNRKDVYSKCRNLIEQLVDLANICYEQQQQQDNENIDSHFLNDQIKLF
IDNKPLLKEKQFRNYETIPNLRNQEQSQTESKDFLADQELQDYLEGRGEWIPQHRFEYQG
EDPLNNDEKYIPNQTLNNYHLGNLVVGIMKDFYSSEIEQSQREVINHFDWLPLKLAILGY
QFSGKKTIANIISKKYGVKLLSIDILMNELIEKYHAYQRQVQQQQREEKIRSSKSSSRPN
NNSVGQIERNDVSGGSNRNNKSQANIAAARISQQQIEEENQQVELDEESIQLAQKIEQCL
YTGQNIPDEYYIKLIQNVLKQIHPEVTEQQFLEQLAQKSIPSENEQLLKLPNLGQDLQMP
PTKEDTFRNALINRTHKYTSGIVLLDFPHTYEQAKLLEKEISGFLPKDEIIQSEFEDSIQ
KAQKIVKPTKVETKPRQLIKPGLDLVIYIDIDKKESLRRALGRRYDPLTKQNFHLDDNPP
PVDNAPLIERLEQIREYGTSELAIVDKNCELDNNFKQLKEWYSMFGNKFEIRTLNEEEHP
LSDQQQSDSRQGTLENNEQVNNQHQAGSMNQNLEENAQNVQDSQPEEQVENGETQNQLVP
QKSKYNVQQDYQIVWQEVNGKDKIDEVFYQVDQIIDRVLIAKEQKYEAIQNKLDSIEERK
KQDEEIARIKKENEAKWLFTTREEILQDLQNFSASIKINPTALKNLVNLWKNTQDIYINS
SKFVFYNLREQKQSILLRFHDIQKRFLELIQRPDQKFMLMRQFQQEYNKFVELNPDMCEE
DQTKEELHQRVEDLHDQLRDEASEERNQIIKSGWIEKEIEKFMLLIQQLLQAELSRSFSC
QQIINDYYVLIQGGELQEIPEYFKNDIVQNQESLPPIEENNNFPRLEKLVDLTLKLHQGE
EEVEEKPGAKKGAAKAPPKKDDKKPPVKKGGKNAVEEVEEKKELTPIEKEQKEAINMEKA
IFRYRVQVIKDFALSKLKLMKAQSQLLYGKLQDWIDYTFKVENDAVNQMDAIFREYIEEE
KKIQKEIQLNFVDIVISHEILNFLTPPPIILPAKEPLYENKFSISQLYIIIEELKSITNE
NNQIESRALLQLLTRKTLNQISKWDLPEFWRNNTIKTYQKLIQNLDPNITGYINSKDICT
YICLSGSHIPTQTEEEGYFEKLKLNSSGDDMIEKAQFINTESWFDEIESCKLEIDTYLFD
RPRYIKELLFYIHKDLETDFIDIDSFIQTISASHYIQLRENEQITTYTDLLLS
Download sequence
Identical sequences 3824.m03219 5911.XP_001030106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]