SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001470729 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5911.XP_001470729
Domain Number - Region: 142-207
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0534
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001470729
Sequence length 566
Comment (Tetrahymena thermophila)
Sequence
MAGNKQKPIKKVKQPSSEEEEEDEDIELDSDQLAQLEDSDDLVGHVEDSDEDEQDQEELE
GDYDEDESLNSDEIPNLSITEDEDDNKASKKGKLKVNLNEDSNSVLGDLNDDDNDDDEEE
ESGDDSNLQDQDLDNIEAEYSEEDEEDEKDKELFQQNVNSSNYFEKILKISKQNLSQIEN
VELIQDILKKKNISKIDLEKEEIYQNDQGEFKKLIDEMSKNSKDEESKLYPITKLTRSKN
LNLEQGISLLNSKNEIFSNYLICLHFYMLYKLNGISLKDSPVVKKLIYYKTLLSKLKPVE
QKMEYQISKLMKFSLKTSEQGKGTKTSTSISQDPISFKPRPELIDDSQGEEDDQEQEDIS
ENVSNLSDEEETKAKKQVIKKKPVAKYVAPKTMAVQQDKAERRLEVEKKRREAYLMRQLK
ANINADINEIKNDRPVVERFAETDKIAKRESEIQKYELNNFVRLQRSKQDKKRIKEFEKN
KAKLDRIDDMSEQKYIRELLHHQKLAVDPEFEKKEKQNLQQTLQKYNKNKNEKQGGNKFN
NGGNKFNNSGNKFNKGPKPTKKFKKN
Download sequence
Identical sequences A4VEL5
3693.m00902 5911.XP_001470729 XP_001470729.1.55412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]