SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59374.Fisuc_0328 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  59374.Fisuc_0328
Domain Number - Region: 37-80
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0361
Family Calponin-homology domain, CH-domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59374.Fisuc_0328
Sequence length 230
Comment (Fibrobacter succinogenes S85)
Sequence
MFSFLNGKSPFDEAEEKLEAGETINGRPKLPQAPIMGWQDGVFLLVLIGLIAGGYYYYQY
AKQKSATMFANCDALYVAAETNAAKYVDAEACYNETWDLGFVSDSMEILRQNRLGAIEDL
RNHQKDLYADAMGAMAARDTVAAYKVVTEYNGPMLLSQGDRKDWNNIANNDAVKASVAAA
VARADSIAKEKAIADSLAQVAAELRAKAVADSIEKANKKLARKGKRKKAQ
Download sequence
Identical sequences C9RKL2
gi|261414739|ref|YP_003248422.1| 59374.Fisuc_0328 gi|261414739|ref|YP_003248422.1| WP_012820170.1.27150 WP_012820170.1.74657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]