SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 595494.Tola_1212 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  595494.Tola_1212
Domain Number 1 Region: 107-273
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 7.06e-38
Family NadC C-terminal domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 4-106
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 5.89e-20
Family NadC N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 595494.Tola_1212
Sequence length 277
Comment (Tolumonas auensis DSM 9187)
Sequence
MRCVLTDEQLLKLLHDDVPFGDLTTELLLTVDKPVQITFAARQDMTVCCVEEAARLFELC
GATSELLVSSGHSVTKGSVLLKATGHTDALFAVWKVTQILVEWASGVASATRALVDAAGS
VPVACTRKQTPGTKALSVKAVKAGGGVIHRLGLSESILLFAEHRQFLTETPAAILQRLKI
QAPEHRRVVEVHDLDDARLWANAGAEVLQMDKFSLEDVRACAAFCRENNLPVILAAAGGV
NAKNAADYVAAGAGLLVTSAPYHAEPKDVQVTFISGG
Download sequence
Identical sequences C4LE09
WP_012729429.1.45904 595494.Tola_1212 gi|237807976|ref|YP_002892416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]