SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59689.fgenesh2_kg.2__121__AT1G63640.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59689.fgenesh2_kg.2__121__AT1G63640.1
Domain Number 1 Region: 471-830
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.45e-115
Family Motor proteins 0.00000107
Further Details:      
 
Domain Number 2 Region: 42-137
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-16
Family Calponin-homology domain, CH-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59689.fgenesh2_kg.2__121__AT1G63640.1
Sequence length 1065
Comment (Arabidopsis lyrata)
Sequence
MSSHLGQDANMNGVYVRSDVSSMLSFDGSDSRESDDSKKGHQSLVEWLNETLPYLKLPWE
ASEDELRACLRDGTVLCSLLNQLSPGSMRMGGSFEPASVKIERFLTAMDEMALPRFEVSD
IEQGDMVPVLQSLKALKASFSDGSYDKNSLAARRRWSLPEDHSDSRGDDRNFTDGFQSKE
GSEIDISDAKISELLKSNSLRNAPTRSLFDMLDKLLDKSMTKMNGHVSHAMASLLSALVQ
VIEQRISNQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTQENEIVTNCMEHIKLEKN
RIEERERSEEKDVVRLRKEKERSDAEIRKLKQELKVVKETHENQCLDLEAKAQKTRDELE
KKLKDAEFHAVDSSRKVKEFEKLCQSKSQRWEKKECIYQNFIDNHSGALQELNATSLSIK
HEVLRTQRKYFEDLNYYGLKLKGVADAAKNYHVVLEENRRLYNEVQELKGNIRVYCRIRP
FLPGQNSRQTTIEYIGENGELVVANPFKQGKDTHRLFKFNKVFDQAATQEEVFLDTRPLI
RSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFLLTQSRQNSVMYE
VGVQMVEIYNEQVRDILSDGGIWNTALPNGLAVPDASMHCVRSTEDVLELMNIGLMNRTV
GATALNERSSRSHCVLSVHVRGVDVETDSILRGSLHLVDLAGSERVDRSEATGERLKEAQ
HINKSLSALGDVIFALAHKNPHVPYRNSKLTQVLQSSLGGQAKTLMFVQVNPDGDSYAET
VSTLKFAERVSGVELGAAKSNKEGRDVRQLMEQVSNLKDVIAKKDEELQNFQKLKGNNAT
SLKRGLSNLRLVGPSSPRRHSIGASPNARRGKAPGLFGRGTSDVDNCSEYSSKHSDSGSQ
QSSDERKHRKDFHQPSKFAGGAKGIDFDDEDVELVGLADADSEERLSDISDSCLSMGTET
DGSISSAVELTLFPETAKPLEITERPEAQMTSEKPEKSVKMGKTEPKDSRTNIPSKIPKQ
TLKPPGQTRPSRLSIATSSSSKALTGAKRPTISTSSSAKPLNRRR
Download sequence
Identical sequences D7KTF5
jgi|Araly1|474991|fgenesh2_kg.2__121__AT1G63640.1 XP_002886395.1.15461 59689.fgenesh2_kg.2__121__AT1G63640.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]