SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59689.scaffold_104139.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59689.scaffold_104139.1
Domain Number 1 Region: 146-265
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.69e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 74-150
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000554
Family Cold shock DNA-binding domain-like 0.0022
Further Details:      
 
Domain Number 3 Region: 32-70
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000977
Family ECR1 N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59689.scaffold_104139.1
Sequence length 269
Comment (Arabidopsis lyrata)
Sequence
MIKTKGRGATDRLKSLSSTTNNSVIVADSIPLNHKEAFFKGHGTSLINGELLTTVCGVVI
NVDKLVYVRTLRARYKPEVGDIVVGRVIKVAQSHWKVELNSSQDGVLKLSSINMHDSVQA
EVGETQRDGSLQLLLAGSHKYGKLDKGQLLKVDPYLVKRSNLHFHFIETLGIDLILGRNG
FIWVGEHAQVQYPMVLDDEIISLKTRQSILRIGNAIRVLSNLGFTVTLEVIMETFNLSNM
ENIDIHDMLGSEFHVLVTENQAERRRRCV
Download sequence
Identical sequences D7KNM4
XP_002893960.1.15461 59689.scaffold_104139.1 jgi|Araly1|891345|scaffold_104139.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]