SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000002297 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000002297
Domain Number 1 Region: 410-515
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-29
Family Calponin-homology domain, CH-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000002297
Sequence length 1138
Comment (Taeniopygia guttata)
Sequence
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQP
GIKNPYRGLVVWPVPENVEITVTLFKDPHAEEFEDKEWMFVIENESPSGRRKALATSSIN
MKQYASPMPTQTDVRLKFKPLSKKVVSATLQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEEDEENRVNQEEKAAKITELINKLNFLDEGEQDLADSSTNPFGDPDT
AELNPFGDPDVEELHPERASSSKPEESFHVDSYNPFKGEDATEYLNPFDEPDAPPEAPGS
VRDSPPQPAKRKNIRPVDMSKYLYADTSRAEEEELDESNPFYEPKPSPALIKVALQEPEK
KMKRKAPEPPNLLPKTEMSISENVSAIPASRELSSSPKPSPIPSPVLGRKPNASQSLLVW
CKEVTKNYRGVKITNFTTSWRNGLSFCAILHHFRPDLIDYKSLNPQDIKENNKKAYDGFA
SLGISRLLEPSDMVLLAIPDKLTVMTYLYQIRAHFCGQELNVVQIEENSSKSTYKVGNYE
TDTNSSVDQEKFYAELSDLQREPELQAGDGALADFASQDDSVFVTDSGVGESESEHQTPD
DHLSPSTASPSSRRTRSDTDPQKSQQSSGRTSASEEIGKCGSADTTQAQPVLGRKKLLIS
DTLDFSDLAHVSDQKEDMSPTVACEDNNKKRHQSLDSTPGFSEQEKLGCIGSTESTRADP
SSPVTKPSLSPTSKPGYSYNMDTDLAKKPHASPRQTESDSDSDARTALNHADQTAKTAQQ
RMLSRQEELKERARVLLEQARRDAALKAGNKQLSSALIPARNKQLNDQQDEERRRQLRER
ARQLIAEARSGVKMSELPSYTEMAAEKLKERSKASGDEDEDDDNIEIDTNEEAPECSVTG
GGDELTNLENDLDSTEQNSKLVDLKLKKLLEAQPQVANSLSSAAQKTVTDSSEQDIKNGT
EEHRAERSQKAAERFRNPVVFSKDSTVRKTQLQSFSQYVESRPEMKRQRSIQEDTKRGNE
EKAAIAETQRKPSEDEVLNKGFKDTSQYVVGELAALENEQKQIDTRAALVEKRLRYLMDT
GRNTEEEEAMMQEWFMLVNKKNALIRRMNQLSLLEKEHDLERRYELLNRELRAMLAIE
Download sequence
Identical sequences H0YVH6
ENSTGUP00000002297 ENSTGUP00000002297 59729.ENSTGUP00000002297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]