SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000003181 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000003181
Domain Number 1 Region: 122-624
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.76e-164
Family Calponin-homology domain, CH-domain 0.00000000218
Further Details:      
 
Domain Number 2 Region: 4-143
Classification Level Classification E-value
Superfamily EF-hand 9.36e-17
Family Parvalbumin 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000003181
Sequence length 631
Comment (Taeniopygia guttata)
Sequence
IHEMANTMQISKDELEELKEAFAKVDLNSNGFICDYELHELFKEASLPLPGYKVREIIQK
LMIDGDKNKDGKISFEEFVYIFQEVKSSDIAKTFRRAINRKEGICAIGGTSELSSEGTQH
SYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTID
ERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLREGKPHLVLGLLWQVIKIGL
FADIELSRNEALAALLRDGENLEDLMKLSPEELLLRWANFHLENAGWHKISNFSSDIKDS
RAYFHLLNQIAPKGQKEGEPQIDINMSGFNEKDDLRRAEYMLQQADRLGCRQFVTPADVV
SGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHL
YGDLQDALVILQLYEKIKVPVDWNKVNKPPYPKLGANMKKLENCNYAVDLGKHPAKFSLV
GIGGQDLNDGNPTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVSWVNQTLKEAGKST
SIQNFKDKTISTSLAVVDLIDAIQPGCINYDLVKTGHLSEDDKQNNAKYAVSMARRIGAR
VYALPEDLVEVKPKMVMTVFACLMGRGMKRV
Download sequence
Identical sequences H0YY05
ENSTGUP00000003181 59729.ENSTGUP00000003181 ENSTGUP00000003181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]