SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000004895 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000004895
Domain Number 1 Region: 191-268
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.31e-27
Family GAS2 domain 0.00018
Further Details:      
 
Domain Number 2 Region: 15-168
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.01e-27
Family Calponin-homology domain, CH-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000004895
Sequence length 313
Comment (Taeniopygia guttata)
Sequence
TPGTGARSIRPYRSSGQYLYAMKEDLAEWLKELYGLDIEVGTFLEVLETGAVLCSHANHV
TQVAGEFARACPDLARHLHLPTAGVTCNLTAQPGTFQARDNVSNFIQWCRKEMDIKDVLM
FETEDLVLRKNEKNFVLCLLELARHASRFGMRAPTLVQMEEEIEEELRQELDLPATEPAL
PRPPRRTRDLNNLDQMVQHLVSRCTCPVQFPMIKISEGKYRVGDSDTLIFVRILREHVMV
RVGGGWDTLEHYLDKHDPCRCTSLSHKQGWKARSPQQPVQHEVRLCPAPRTARSPQPALL
VSRSQSPLPPVTW
Download sequence
Identical sequences H0Z2V3
59729.ENSTGUP00000004895 ENSTGUP00000004895 ENSTGUP00000004895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]