SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000009272 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000009272
Domain Number 1 Region: 45-195
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.17e-30
Family Calponin-homology domain, CH-domain 0.0022
Further Details:      
 
Domain Number 2 Region: 216-294
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.14e-28
Family GAS2 domain 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000009272
Sequence length 341
Comment (Taeniopygia guttata)
Sequence
QVTMQNAIQVWFGDELPLSPRSPLTPRHGPGLADVCLYDQWISVRHEATLVPMQEDLSIW
LSGLLGMEVKAEQLLEELDNGVLLCQLIDVLQNTVKKCCNTNNLRNFPMRKVPCKKDAPS
GSFFARDNTANFLNWCRAIGVDETYLFESEGLVLHKDPRQVYLCLLEIGRIVSGYGVEPP
VLVKLEKEIELEETLLMTSGPPSPLSTPKSCCHHGELHEAVKHIAEDPPCSCSHRFSIEY
LSEGRYRLGDKILFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPCRVLQFATLEEKILAFQ
KGVTSDSVPSLSARNQEPPLMNPMSAVNMFHKQPSKPPAPV
Download sequence
Identical sequences H0ZFB0
ENSTGUP00000009272 59729.ENSTGUP00000009272 ENSTGUP00000009272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]