SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000009298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000009298
Domain Number 1 Region: 332-453
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.38e-33
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Weak hits

Sequence:  59729.ENSTGUP00000009298
Domain Number - Region: 18-88
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.017
Family Mitotic arrest deficient-like 1, Mad1 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000009298
Sequence length 456
Comment (Taeniopygia guttata)
Sequence
MAGEIEHLNSREAQTVCDGLEHYEDTLRGAVREIHVDIQLFKQGVGRQVEEVLRLASPLA
QAVSELQQENRRLRVQLERLSRQVEALGRSAGLPQEWVNEAAKRSQVVEPGSPAQGSADG
AFSGRAKLTVAGRSQSVDLDDHQKPEFRRVFSSSIIENGHRSSSSGRNRVTRELTCFQMS
ESSSPEAHAPAVILQMPHLPVTAVTRTSEKFSGENICPTNTSSCLLGQGKSTNTMGLFWF
YIENATSVTKPASTMNYGLRSGAKTGESAIDSYCEVTPSSQSPPPTVHRQVERRRELVRS
QTLPRTAGTQARKALFEKLERDDGKGKGESRAKLKRSLSFGVASASSIKQILLDWCRSKT
IGYKHIDLQNFSSSWNDGMAFCALVHSFFPEAFDYNKLDPANRKQNFELAFTTAEKMAHC
DRLIEVEDMMVMGHKPDPMCVFTYVQSLYSHLRHFE
Download sequence
Identical sequences H0ZFD6
59729.ENSTGUP00000009298 ENSTGUP00000009298 ENSTGUP00000009298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]