SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000010945 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000010945
Domain Number 1 Region: 703-923
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-39
Family DBL homology domain (DH-domain) 0.0013
Further Details:      
 
Domain Number 2 Region: 1082-1281
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-33
Family Pleckstrin-homology domain (PH domain) 0.00015
Further Details:      
 
Domain Number 3 Region: 913-1029
Classification Level Classification E-value
Superfamily PH domain-like 1.77e-21
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000010945
Sequence length 1283
Comment (Taeniopygia guttata)
Sequence
AGESIPACEKLRQEEEEELPEILEMADRCLAQNDDHSVHAELDLNMEGDLENDDCASPDM
LPEEASEETGPDLELCGDELSARNGLAEFIHQAAVEDEEVDPNEHNNTNMGNVSDGCQIT
ERKSEKTSEVAFEASKDSGKEEEETVNADNMDDRCQIAPCENECHEEIPVEHSDEDLQTE
EASLHEDGMISDSLPCSLGMEPELEAVTVEKHSGNTVEASKSDELQLKDNEENLTVPEVV
IVTDESEERETSSDSPDDPYVLPEENDTVYDVQTDLGADHSKRGELGIDGENNLLPTDRK
SIVTRTRSLSGRMPGYVPETVPEETGPETDLPSSRNASGIEELSNNSFSLEGQPVEANKA
LPAKSRRFILYPRSYSVEGREIPISVYRESDVCVLDGVRIKRTEDNLSLPCVNGSSGSFS
QQNHLSSCGLSTPSSVVDIPPPFELAYITKKPITKSSPSLLIENDSPAKYSKKKKSSFKK
FLTLKFKKKTENKVHVDVNVSSSRSSSESSYHGPPRLMELEGRSLSSSPQLKSHVGKLRA
SESPSAVLFYKDGKRKGTPKSFSRSVSRVESFEDRSRPPFMPLPLTKPRSISFPNADTSD
YENIPAMSSDYENIQIPPRRSTRAGTFTEFFEDPSRALSAANENDGYVDMSSFTGFENKQ
QTTDQETESAYTEPYKVCSVSVTPMEVVTSDEEQNSSEDDESSLGDPSLTNKKEGQSRAY
LIAQELMSSEKVYVEMLQLLRMDFYEGILKVLGDDDENEQEEVKLKQGLSELPEIYDLHQ
DILEELEERVLKWAEHQKVADIFLSRKSRLNHHTAYIMQFDRNLALLDEMCLKYSQLATM
IQEFEQSSSNSPYSVKHQLLKVVYRVFQYRVMLTDYLNNLCPDSTEYEATQAALFIVSEI
TDQANDSMLQAENLQKLVHIEHSVRGQSGLLQPGRIFVKEGTLMKISGKNRHPRHLFLMN
DVLLYTYPQKDGKYRLKNTLAVSSMKVSRPVIEKAQNILKIEYDEHCLTLSASSCSERDD
WYSCIIKHIPDDCKAHKTSTFHSSVELRERLGIPLGERPPTLVPVSHVMMCMNCGCDFTL
TLRRHHCHACGKIVCRNCSRNKYPMKYLKDQAAKVCDSCYVELKKRGKIPSFLLAERPLS
VSFPPTSSRCSSSAFSSVFHNIHYSSFKKQKKIPSALMEVAASGEGATISGYLSRCKGGK
RHWKKRWFVIKGKVLYTYIANEDKVATESLPLLGFTIAPEKEEGNMDTVFHLYHKQTLFY
SFRAEDNNSAHRWIEAMEEASIL
Download sequence
Identical sequences H0ZK25
59729.ENSTGUP00000010945 ENSTGUP00000010945 ENSTGUP00000010945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]