SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000012346 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000012346
Domain Number 1 Region: 5-207,253-363
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.55e-52
Family Calponin-homology domain, CH-domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000012346
Sequence length 365
Comment (Taeniopygia guttata)
Sequence
MSAAPVRSPTLRPHRMKKEESFLGKLGGTLARKIKAKEVSDLQEEGKNAINAPMNPSTVD
IHPEDTLLEENEERTMIDPNSKEDPKFKELIKVLIDWINDVLVEERIIVKQLEEDLYDGQ
VLQKLLEKLADRKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPHGWTIKWNVDSIHGKNL
ISILHLLVALAMHFRAPIRLPEHVSVQVVVVRKREGLLQTTHVSEELTTTTEVLTFSLER
DAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEDYF
VPLHNFYLTPESFDQKVHNVSFAFELMQDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTK
YKNVE
Download sequence
Identical sequences H0ZP17
59729.ENSTGUP00000012346 ENSTGUP00000012346 ENSTGUP00000012346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]