SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000012916 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000012916
Domain Number 1 Region: 8-123
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.3e-23
Family Calponin-homology domain, CH-domain 0.00098
Further Details:      
 
Domain Number 2 Region: 1033-1122
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000434
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000012916
Sequence length 1690
Comment (Taeniopygia guttata)
Sequence
AVTRQSFETEDFRAALENGVLLCDLINKIKPGIVKKINRLPTPIAGLDNINVFLKACENI
GLKEAQLFHPGDLQDLSNRVTVKPEETNRRVKNVLITLYWLGRKAQSDPDYNGPYLSLKA
FEKLLGQALSKALEESSQPSRSGRDSGYGDIWYVDRAEPFSSSVTHKRDDSFDSLDSLGS
RSCTSFSSDITLKGGSEGCDSDTDSELPAKMHDSHKDDRSYRRISMIEPKPTTDFNRFLP
NKNKQTAYVPAPLRKRRTEKNEDNRRSWASPVSAESDGAFSRYLQRQLDTKEENKPRVNN
PSQLSGYCDEDEEEAGIPNIEKDDLYFRKLSSSAPNTVVAFDKFLPKFWTPEEEFLWKKI
KKSSFKPWYKEIQGFSQFSLLQALQKYTDYVSSEMETRIDPASGPRLIKCRKNVSFIPGG
KQEDEENGYLYPDLENDDLFVRKTGAFHVNQVVLQDPRYLKKFSQQEPPLEGEIILQPRE
GQTVIPDLEKDDMIFRKVLSQKKEVPLSGAPDKYHPALFPDPWSLPEEIRSKFLCLLEKN
AIPEERKSNGRVLSPSLHHKKDDMLTRKIESWKVGSNVQPVNFIPGPCSEEDWKKWEAIR
EASKVRHKKRQMVERSGCCHFGENMSKSLNDVSAEELQTLRKIRYEELQKIKEQLQEQDL
KWQEDLAKWKSRRKSYTSELQKKKEEREEIERRASEVSGRSTKSLKEMQQERSEYCFLQT
TARILMYATELVNCTIPSPLVTLCLKDYPCSALHFRNIEHCSVMGLSYSCSFLNKSEFLR
MCLPVYQDSYEQQKQHNWAYSLNDDVFSEEKAPSTAAKDWSAAKDYRLEEDRSYSTKDSK
SMYASQPPRENLPESSAAQEAPAPPEGLEREQSPALLSTRYSVNAQTGSAQVSASLPRTY
QKTDTSRLTSVVTPRPFGVHSRGISSLPRSFTMDDAQKYNGEVEKAKRTQTLFTSISFSQ
PDSAHPLSTGEEEEEEKGVQSTPPPSLALPLKFQDQDAGSSIPRPEYGIPPDSLSLASSA
ETASLTEPKDSKSMYSEMRISINQRPGHSRSFGFTTNWSSSGAIVQTVEEGSPAALCQLH
VDDEIIAVNGTKVSHMDYSQWEEAISRALEIGNLVMDVRRYGKNGTSENKWIDATSGEKI
SNASTTSTKRDFSSSLQSSVSIVLKVHGRWGEEEKMFNRTSEPISLKNLKRRSQFFEQGK
SKSTFHLPVPSISAPSRRVWDQEEERKRQEKWQKEQDRLLQEKYQREQEKLREEWLRAKQ
EAEKESSKYFDEEQTVLTLNTTSITSQAPPVSSWRASPEANAPEEPERDGENELAASLLH
EEEGRRRLQEEQRIQEEAARHFEQEQELQELELERQRKEREQQHTEEQRQQAEKQREVSV
EVPQYQRCAKYCRIVFLSKDRRFRHNTKSFLKNQPSDSTYKASRRNTNSQVCVPAQKNKS
KSTTELNEFNTIRNGTQSKYSERSWNMGESQKKSQKEQNLSAAELERQQILQEMRKKTSL
HTDSSWIRQRSASIHKEPVSLYSSSMRRGESLDNLDSSGMRSWRHHSWLHQSASSSSLSS
SQDISRPVSTSNRAYMCTPSSSKAPPVATSVRAPSTSQTAPRAQSPLSASQSGSQTRSRS
VSGKKICSYCNNILGKGAAMIIESLGLCYHLHCFKCVACGCDLGGSRSGAEVRIRNNKLF
CNDCYIRFKS
Download sequence
Identical sequences H0ZQM6
59729.ENSTGUP00000012916 ENSTGUP00000012916 ENSTGUP00000012916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]