SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000014298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000014298
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000138
Family Complement control module/SCR domain 0.00046
Further Details:      
 
Weak hits

Sequence:  59729.ENSTGUP00000014298
Domain Number - Region: 65-96
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000187
Family Complement control module/SCR domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000014298
Sequence length 96
Comment (Taeniopygia guttata)
Sequence
CGAPPNLTFAELTREYKNQLEFAVGDTVHYSCRPGHSRRHGVPPTLTCLQNHTWSEALEF
CKRKQCRHPEPPRNGRVVVLTDLLFGSTVNHTCDEG
Download sequence
Identical sequences H0ZUK1
ENSTGUP00000014298 ENSTGUP00000014298 59729.ENSTGUP00000014298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]