SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000015879 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000015879
Domain Number 1 Region: 44-151
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.57e-20
Family Calponin-homology domain, CH-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000015879
Sequence length 151
Comment (Taeniopygia guttata)
Sequence
FSVLKSLQVWFGDELPLSPRSPLTPRHGPGLADVCLYDQWISVRHEATLVPMQEDLSIWL
SGLLGMEVKAEQLLEELDNGVLLCQLIDVLQNTVKKCCNTNNLRNFPMRKVPCKKDAPSG
SFFARDNTANFLNWCRAIGVDETYLFESEGL
Download sequence
Identical sequences H0ZZ26
ENSTGUP00000015879 59729.ENSTGUP00000015879 ENSTGUP00000015879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]