SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000016318 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000016318
Domain Number 1 Region: 2-162
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-44
Family DBL homology domain (DH-domain) 0.0000000696
Further Details:      
 
Domain Number 2 Region: 166-292
Classification Level Classification E-value
Superfamily PH domain-like 1.85e-36
Family Pleckstrin-homology domain (PH domain) 0.000000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000016318
Sequence length 293
Comment (Taeniopygia guttata)
Sequence
VLQGYAAEMDNPLMAHLISPELQNKKDILFGNMEEIYHFHNRIFLRELETYVEYPELVGR
CFLDQMEDFQIYEKYCQNKPRSESLWRQFSDSVFFQECQRKLDHKLSLDSYLLKPVQRIT
KYQLLLKEMLKYSKNCEGAEDLQEALTSILGILKAVNDSMHQIAITGYDGNLNELGKLLM
QGSFNVWTDHKKGHTKVKDLARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKH
SLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEVKATWVNEIRKVLT
Download sequence
Identical sequences H1A0B0
59729.ENSTGUP00000016318 ENSTGUP00000016318 ENSTGUP00000016318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]