SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000016363 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000016363
Domain Number 1 Region: 5-177
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.02e-25
Family Calponin-homology domain, CH-domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000016363
Sequence length 195
Comment (Taeniopygia guttata)
Sequence
VSELQEEGINAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRNDPKLQELMKVLIDWI
NDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTCLGADA
SCRRCKGIALKVYFEVSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGI
LQSRQIQEEITGNTE
Download sequence
Identical sequences H1A0F4
59729.ENSTGUP00000016363 ENSTGUP00000016363 ENSTGUP00000016363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]