SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6035.ECU01_0620 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6035.ECU01_0620
Domain Number 1 Region: 16-120
Classification Level Classification E-value
Superfamily ENTH/VHS domain 0.0000745
Family VHS domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6035.ECU01_0620
Sequence length 165
Comment (Encephalitozoon cuniculi)
Sequence
MTSLSREYLLKSLINLLPTEEQMKTVGLFIRTFKKDYRAIVDGWMFVYGKSSAYHKLNLL
YLANEVVQTTRDADPDSIELKIMFKKAVNEVFEETKKATMENPSLYKKYCELENVWVQRN
VMVMESHGINLGELVRSIEKTFNDKAKLSAVLKDALARIQSSSGG
Download sequence
Identical sequences Q8SWM7
gi|85690995|ref|XP_965897.1| 6035.ECU01_0620 XP_965897.1.88742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]