SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6035.ECU03_1080 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6035.ECU03_1080
Domain Number 1 Region: 2-232
Classification Level Classification E-value
Superfamily PIN domain-like 5.89e-65
Family 5' to 3' exonuclease catalytic domain 0.000000847
Further Details:      
 
Domain Number 2 Region: 217-342
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 5.98e-27
Family 5' to 3' exonuclease, C-terminal subdomain 0.0000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6035.ECU03_1080
Sequence length 345
Comment (Encephalitozoon cuniculi)
Sequence
MGIKQLSKLLRENSKRGIRERPLVYYSSKKVAIDASMSMYQFLIAVRSGGATLGNEDSPT
SHLVGFFYRTIRMVELGITPVYVFDGVPPEIKMKELEKRKERRAAADREYREASEVGDKE
LMEMYDKRKTKVTGVHVDECKRLLGLMGIPFETAPSEAEAYCALLCKKKAVYGVATEDMD
ALTFGSPVVLRNFNGTQSKRLPVMEHNLPQILEDLSLDHSEFIDLCILLGCDYCSTLKGI
GPKKALGLIKKHRSIGNILKNEDLEVPGDWRYSDAQKIFGSLAEIGEIRDFNISWDSIDR
NGIVNFLVEEKGFDLERVNKGIDKLINSRKKGTQGRLDCFITRSK
Download sequence
Identical sequences Q8SS91
gi|19173066|ref|NP_597617.1| NP_597617.1.88742 6035.ECU03_1080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]