SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 60481.Shewmr7_0183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  60481.Shewmr7_0183
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 6.28e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000267
Further Details:      
 
Domain Number 2 Region: 68-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.96e-23
Family Ribosomal protein L11, C-terminal domain 0.0000608
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 60481.Shewmr7_0183
Sequence length 142
Comment (Shewanella MR-7)
Sequence
MAKKIDAYIKLQVKSGSANPSPPVGPALGQKGVNIMEFCKAFNARTEKMEKGMPIPVVIT
VYSDRSFTFETKTPPASYLLKTAAGLKSGSPRPNTQKVGTIARAKIQEIAELKAADMTGA
DVEAMTRSIEGTARSMGLVVEG
Download sequence
Identical sequences A0A220UHR8 A0A252ES34 A0KRL3 Q0HNU8 Q0I0B6
WP_011621019.1.3750 WP_011621019.1.3791 WP_011621019.1.419 WP_011621019.1.57664 WP_011621019.1.64021 WP_011621019.1.71012 60480.Shewmr4_0188 60481.Shewmr7_0183 94122.Shewana3_0188 gi|117918646|ref|YP_867838.1| gi|114045696|ref|YP_736246.1| gi|113968533|ref|YP_732326.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]