SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 60481.Shewmr7_3811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  60481.Shewmr7_3811
Domain Number 1 Region: 2-129
Classification Level Classification E-value
Superfamily MAPEG domain-like 4.32e-23
Family MAPEG domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 60481.Shewmr7_3811
Sequence length 138
Comment (Shewanella MR-7)
Sequence
MSIIYPVFALIILTFVVGFCMGASRLISVKKGHVDPQYYKLLSGYTPPDYVIKLSRNFSN
LLEVPILFYILGTLLVALNINSPIILNLAWCFVGLRIVHSIIHITYNHPKHRFYAFLASC
LTVLAMWIYLIILITNGI
Download sequence
Identical sequences Q0HQ17
WP_011627535.1.64021 60481.Shewmr7_3811 gi|114049295|ref|YP_739845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]