SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002154993 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  6085.XP_002154993
Domain Number - Region: 5-52
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000289
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002154993
Sequence length 387
Comment (Hydra magnipapillata)
Sequence
MSYRDLRNFTEMMRALGYPRLISMENFRKPNFPLVAEILQWLVLRYDPNSDIPMDVEFEN
DRVLFIKSVAQFMALKAHIKLNTKRLYEADGLAVKEMIKITTVLYQAAMKLNKSGDEEHG
TSKYHPGKFDFNSKLSDLKLARQLASEITVKGSSLHQLLGREVELRAIRRSCIAQPMDLN
EIEKNVTNVIKSTQAEIAKTHSQLDNISSDEANLQAKIEKRKSELERNQKRLKSLESVRP
AFMDEYENLEKDLQELYASYIEKYRNLAYLERVNEDMNKSEQNDDGSENPINMSLKAREE
NENLIRGNLTLGSSDEDEETQETSNKDEKKQVVPKPKMIGSLTGDLETDDESEGGSTATE
DEDELLEGEEDDEEEANDQANDSDDNF
Download sequence
Identical sequences T2M8C5
6085.XP_002154993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]