SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002157520 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6085.XP_002157520
Domain Number 1 Region: 106-224,260-314
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0000767
Family ADP-ribosylating toxins 0.052
Further Details:      
 
Weak hits

Sequence:  6085.XP_002157520
Domain Number - Region: 15-81
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0345
Family Calponin-homology domain, CH-domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002157520
Sequence length 394
Comment (Hydra magnipapillata)
Sequence
MFEQVNRSLRFVDTSKDDICKSSNLNDLVCFYQGDLVHKRMDAVRKSIFYIRENWNLFEQ
FMNSLQKFFMQDFDIKDIKSHPLSKIFERKRNWCNVEENTADLPLKEEFSVIHTYTTDEG
FAQIFKIANNIFRDDSSVNLEEKIRNVVFLIELLNIDLFNYVHRFPEHQSFEDTVYRGMV
IPADNFKVFEDLMLQPIEKRYISIPLGLWSSSINLETAITFVRNELEKRVPGSMEIHKRV
PLLMKIRVLNIENKLLNFYRKKYNQSVVSTICAVNIADLSKFPGEKEVLLRGGFFQALNI
FSQVIDDVNFKVLDLVMLNTNRDHLYNPTRLGSLDDEARILFGNMVGFTRNKYIVEYCKE
RNLPEDMLLYEKPLSNNEKKLRELMGLNYDEKII
Download sequence
Identical sequences 6085.XP_002157520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]