SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002158061 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6085.XP_002158061
Domain Number 1 Region: 69-432
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.74e-106
Family Calponin-homology domain, CH-domain 0.0000000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002158061
Sequence length 449
Comment (Hydra magnipapillata)
Sequence
MDNEKPSSTLYCCPVRFQYVKESAELYCSVTTKGVFGQWTSKIVAPKDLTKVGGTSEASA
DGTAHSSSHAEEIAFKDWINSELKNDVDCKTLLPIKSADELFEKLSNGIIFCKMINLSVK
GTIDERVINKAKLNAFLIRENNALAVNSANAIGCTVVNIGPEDIAQGKRHLVLGLLWQII
RIGLFSKISLAQNPNIAALCEDGETIDDLMKLTTEELLLRWVNYHLAKSGSAKRIKNFSG
DIKDSEAYAILLNQIAPGEAHVDRPEHIISSSDHTKRAEMLLRNADKINCRKFLTAKDIV
SGNSKLNLAFVAHLFNTHPALDASDMNFEIYVESREEKTYRCWMNSLGVSPFVNHLYNGL
NNGLVLFQLFDAIRSGTVNWDKVNKAPFKAIGGKMKKVENCNYVIELGKANKYSLVGIGG
EDIHNETHTLVLVIFMPPKVMVLTAFLFG
Download sequence
Identical sequences 6085.XP_002158061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]