SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002160996 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6085.XP_002160996
Domain Number 1 Region: 12-239
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.24e-39
Family Calponin-homology domain, CH-domain 0.00027
Further Details:      
 
Domain Number 2 Region: 283-382
Classification Level Classification E-value
Superfamily E set domains 9.34e-18
Family Filamin repeat (rod domain) 0.002
Further Details:      
 
Domain Number 3 Region: 463-557
Classification Level Classification E-value
Superfamily E set domains 8.01e-17
Family Filamin repeat (rod domain) 0.0018
Further Details:      
 
Weak hits

Sequence:  6085.XP_002160996
Domain Number - Region: 586-667
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000154
Family Thioltransferase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002160996
Sequence length 669
Comment (Hydra magnipapillata)
Sequence
MRKKKNLDEQKSFRSQDSQIQEKAFIRWCNLFLKSKGFEIDKIIDLQDGVYLIILLEILS
GKKLQENIIDGDEDYVNNWKIILKHMKNEGISISNPVDNSDEASIIHSLTFILWEIILRY
QIFDETITDMTLLNVDYNRVSRNLLKWVQSKIPNCRIENFTSDWTDGIALCLLVNAIRPD
TIPQTMFQNKYNPEMNVRLACTTAEDELGIPELIAPYDIANGNVDEKSMITYIAIFRSAD
RMVRRGIKTKTYTSDFSMSESETESIFDKDGSKALHKKLGIPYKSPRCLAFGAGLRWGQV
GRPTDFIVRLNGAQASDLSVSIECRPYDHRVALYKPELQIKPIEESSYIVRYTPTRPGEY
VLSIFCGGDHIEDSPFRLSVRETVLMPNRLSDEEININLDQENIQLTTKTLTNCLEENDS
KSNFSENLDSKSTDIKSAPSWLDKQTRDIYRKLGKFINQETATMKAYGKGLISGEVGVVS
AFNVSTPNTERGPLSVCITCPAMSIPVPCVKTKLQPTSLLHEVLYTPTEPGIYEIEVFWS
EKPIPGSPFRLTINDVEKKEVNLTENSNKLKEYCRSKNDISITDEVKIYYSATSKNIMDH
YCKDQMVQVAKENISENVLLIAADLELNSSERKVLYEKTNFKQLPFLFLNEEFLGDYDEV
MDEHMKQNL
Download sequence
Identical sequences 6085.XP_002160996 XP_002160996.1.79663 gi|221129730|ref|XP_002160996.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]