SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002162291 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6085.XP_002162291
Domain Number 1 Region: 16-178
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.99e-40
Family Calponin-homology domain, CH-domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002162291
Sequence length 193
Comment (Hydra magnipapillata)
Sequence
MANRPLGYGLTAEIKRKNEKKYNYEDEQDALCWMEAVIDEGEVFLGIEGMNNTAAILKDG
VYLCKVMQALSPELIKKINSPNTPFKCMENIQLFLNACREYGLKNEDLFQTSDLYDSVNI
KNVIDTIHALGRKAQDHGYDGPILGPRESKRNPRSFTNEQLDKGKKIIGLQMGSNKGASQ
SGMNFGKVRSILD
Download sequence
Identical sequences 6085.XP_002162291 XP_002162291.1.79663 gi|221127084|ref|XP_002162291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]