SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002163874 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6085.XP_002163874
Domain Number 1 Region: 17-173
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.8e-23
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 
Domain Number 2 Region: 202-266
Classification Level Classification E-value
Superfamily GAS2 domain-like 4.84e-18
Family GAS2 domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002163874
Sequence length 277
Comment (Hydra magnipapillata)
Sequence
MPTLEDEDYFMVQINERNEKSLIPLMEDVAEWLSTYICLDINVNNFLDMLDDGVALCMLA
IKIQKLSKESKVKSKILSNEAYIIPEVLPPFEFNFHHQVKKKSFFARENAENFLKWCRKI
GIRDSTLFVSEDLVLHKQTKNIILTLLELGRIVHRYGIEVVPSIVNLEIEIEEENQNSFD
WMRNVTIRKKKRCKTLDLDAKVQRCARKYNVAVEKISEGKYLINKKLSVFIRTLRSHIMV
RVGGGWDELDSFLNRHNPDKQRSKLSFSHLVCDAQLE
Download sequence
Identical sequences 6085.XP_002163874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]