SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002163951 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  6085.XP_002163951
Domain Number - Region: 37-103
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0823
Family Calponin-homology domain, CH-domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002163951
Sequence length 143
Comment (Hydra magnipapillata)
Sequence
MAISKSDDDLIGLANNIVDKLNLSPSILTINQCNHFFFVQVYESILGEKPPGLNSSPVSI
EDQIHNVQVVVDSLATDVLDMDLSHIDVQGIVQQNKVQVKNLLEVFDGLLDCLLEELNYE
DNFYECTKNKGDDQTKINNSNQN
Download sequence
Identical sequences XP_002163951.1.79663 gi|221130936|ref|XP_002163951.1| 6085.XP_002163951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]