SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002167898 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6085.XP_002167898
Domain Number 1 Region: 8-151
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 4.45e-47
Family Nucleoside diphosphate kinase, NDK 0.00016
Further Details:      
 
Weak hits

Sequence:  6085.XP_002167898
Domain Number - Region: 153-192
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00915
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002167898
Sequence length 212
Comment (Hydra magnipapillata)
Sequence
MNENTTFINIEQTLALIKPDAIDHAEEIEDIILSNGFLVLQKRRVQLTPEQSSDFYAEHS
GKIFFPSLVAFMSSGESIAYLLARNKAIEHWRKIIGPTNSAKARDEAPTSIRALYGTDNY
KNAVHGSDSLKSAFREIQFFFSNGIIEPILSNDDAKDYLRKYVNPTLLKGLIQLCKRKPI
EPIIWLSDWLANNNPYRPRIVEPENPIVQEPI
Download sequence
Identical sequences T2MEZ8
XP_012554480.1.79663 6085.XP_002167898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]