SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002170657 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6085.XP_002170657
Domain Number 1 Region: 1425-1542
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000196
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 
Domain Number 2 Region: 213-322
Classification Level Classification E-value
Superfamily PapD-like 0.0000314
Family MSP-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002170657
Sequence length 2791
Comment (Hydra magnipapillata)
Sequence
MKGTRHAKKLVKIMADIIIQILGIQINILFFYRVELESQTNHHVLIIKANIVLRSLQLLS
YDNKIIDCLRFGYVYYGTDVVQTLWLYNNSPQESKFVAVIGSCDGEEMGVDITKKTICSF
VDDFGENWRHEKSAFFSVSPCEGKLDPFQKTKLYFKFSPKYMQPLKGWKSIMRIPSREDF
AMFIRISSVGVLQNPMENLNVELAMTGTALPVSLSIFPSQFINFDKCFIGNTSKVVITLN
NNSPHLSANFSIKSSAHFNIEPACGEIDINGTQEMVFSFIPKQMGNQRKKFLLDIIGFEC
EINDCQQILYKKIVNKTYLFCCTGIGLYQKFPKPLNTTSLGSSLIDVVIDGEHQCSKNLQ
NTCEKSHKIKKKIVTDKKVNKNNTGGAEKVVNYTSVFNSMTNRSAALEYTEVLTPKELHN
IRIGLRKHVTLINDQNISAKFTWFIERTVDAFSSMECEVVFYPSYSASFNEEFVCKVENG
NTLHLKCSAELGITSCSFVESRLLFGNIPLNLTTTRSVLLKNDGKNHAYFQVINPSPLEG
ILIYPRENVIPVGGFVKLQISFKPTVPQKFETLLEIDVLSGKQISLRFSGVVDTPNVDIS
VVSIISCWFDSASGVYGGSISKLPFEIINLVATYDFIIPCIVNDLDPMSIYFSSLYHKIL
KRVQGIALRQPLSISEKKLEFSLSSSYFEGDLNNKNDCIQVICLKNISNETIKWSLDISN
QPLVKQSIFILDVGNSVMHLKSGEEFNLAILFKPNLVQVYSYIELNGKVLLPKLVFQPEF
IHIPPVPLCQITSAEVDVLAYNYTRFCELSIYIPKIEFNGENFESLLSVELPNGSQIKKL
HESETQVIKIIVKFVSAKPIFFSTQITLTDKFTMELNNGSKKQTFTEPKIGRKQGKRPNL
WKRFVKREKGMAYKTRKDASGDDKETLRPSYDSHKFHEKEAMDEKNSDKTASAADKSIRS
ITFNLEAVLPLPFAGDAQIFYMRKLAIYNFTIYETSTKKGICYLWDESDGKRGANEINTA
LLDYMKSLPVSVKKLSLGRNLGADTSIPVSKLARICCSGQNRNQFIVATMMYIVQTTHLE
CIDMKYMESGHSYLEVDSMHSTIERTLPVPKYLIDSSIPKAANFFLKQTMMVEVIFFFSL
PVTASADNCLLTCSNFLINNQCDFHIICKEGKKSNSGTSSLFVPCLSAIESAVAPSFSTS
NTSLYTTTYQNSEPMGSSQFSDHSYSKISECNIVQRWFSSQCWSFGSFPIYLPYTLRENF
SVEVFIWRITNSSLEGKVRFMNVFDLIAHLYGKSIPGITVKMLLSLKKEEDLVKCIVEMY
LKMLTFLSYQGAIFSSIKPEYFLNFSDFKRFKQLENCYESEKYHKSSDSFELLSKKSWTS
LLLQIYKIYVLFRISPQICKSSFPFDYPTLPGFNSDPNCSNIYSSSERVILSWLNHHYEQ
QRIKCWKIAPPSRWIVNFENDLVDGLVLASVIAAYAPFLVKTHIYKMYVQPSTTEQLHHN
CLKIIEMLHILAIDYDIVTEDFIKSSPISMLMLCVYLIQNLPLYLPKSTIEFETSLHSLA
TKHIKITNPSGKPLFYQALLFGDYSSQFQMPNGFKIQVPPKGFIELPVEYVSRFVHTCQC
TLLLVGIRGEMVFGSTLAFCLKGTVNSLSVSNHFKYVSPCYELLKITVKVECPFPCNEIF
KVFLVETGPVELGSKITCRQKRILKKSYKKPELNQGIKNQYFESKPINLESKKKPLLSAF
WCASKSIYIKTGLDSSIELEFLPFEIGTRHCSILFSNEKVGDFLYLIEAESILPLPLGDP
FINGPFRMTSAKAMQQSSGTLKEDNHTIYLHCNAGEECVAEINFDYLNSGKERALVVAAR
QRMSDEELRRRDVTGMTSYQTILSKVSLLQISRENYIQPLDVLNINNLQKEFKVEVSSPF
FSAPDKVVIPNDSNTSGLSSIKVPITLKPSIPGQYHCKVIFFSESDIRVYEIECTVKAKN
SFVELEFVTPTHECVVQNIPFVNHSDFDWNMRSEITGEGFFGPECLVVLSKTTSYYPLSF
KPIYEGTINGCLKLCNISNGVENTFTLKGLGSQPHPVDVINIECIVNEPTLKVLELKNNL
PFKMVFQTFSDLSIITGPLFVPVLSRQTVQVPIRVLALKRGYTEGVICFVYDVGSNTSVG
VNRIRNESDGEEDYNCTAFMSSLSVQLASLTLLEKIARPYRIWFQLNINAFPGKAVKTLF
ASSYIFSSTDIEIFLNNPLDKDLNLNVVINGVGLDGITEFILPSLESITYHVKYSPTSIG
KQKASVIFQSDLCSEFWYELDLFAEEALPQKLPLIKCCLGCCKEASIHLENRYAYSVCYN
VSCSDSKNFLLRGVDDKLCLPPSCSIEVHFIFTPSSIGHHQGIVVFQNELIGNQTFILSG
LGEAPELKYQFIHARFGESASTIIQFHNSFECSVSLEVQLQSENSDFSMLSKPYTGILCS
SKSDVYIPISYSAQSMESSQCTCYIIPELIYEETEGEQFHDKMKFKWSYVVQGIPIIEPI
KDSLAPALTCRAREKLEKKIFILLIKESFISSRDKTCQHSVFPVRIFGDHIDSFNNEAQL
CEDFDFKLEFDNKEIEDQVQRSVLITLEKKYIDCDYAAPNLVFKLVFFPSKPFCYLVHLA
ITSPKGGVWKYPFKFVSNEAVPDDVIMIRAVGLNKTAHVSFRLNSQAEVESEFTAHISTG
SDKMFEVTPQAGILAPINTEGVLFTLSYKPLYYGKEHKTKLTVQSKLMQWIYEVRGVTPE
YQPPKADAAIISHNKTQKSNKKKNFVIKNLK
Download sequence
Identical sequences T2MIZ7
6085.XP_002170657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]