SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6182.C7TXR1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6182.C7TXR1
Domain Number 1 Region: 111-614
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.35e-130
Family Calponin-homology domain, CH-domain 0.0000000187
Further Details:      
 
Weak hits

Sequence:  6182.C7TXR1
Domain Number - Region: 7-86
Classification Level Classification E-value
Superfamily EF-hand 0.0567
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6182.C7TXR1
Sequence length 652
Comment (Schistosoma japonicum)
Sequence
MTTIESLTQEQWDDLFHNFESLRESNNIAWSDIKRALEIVGVSVAGHEIRDLVGQPRNWL
NLAEFNDLYMRAKDMKDTTKAIRKALLLKHSEDVKSFTVGKNDTDTRHSVSKAEERGFTL
WINKRLGHDTELQNEILPIDPSIDGQLYQRCKNGILLCKLVNVASPDTIDERSINRGAAL
KNVFNVHENLTLAVNSAASIGCCVVNTGPEDIMQGKRHIVLGLIWQLIRRGLVDTITLNK
HGELLALLHDGENAEDLAAMKPEELLMRWVNYHLHRAGCDRRITNFNSDLADSVVYAHLM
EQIVPLDKRYNLMSADEILSSTSRQERAINVLNNAETLNTPFLLAPEDIYLAGDKDKENR
DRLNLAFLATLFNMYPGLDTTRGDLLIEGETLEERTYRNWMNSLGVKPYVTFLYTDLSNG
LVLLQLVDKIKSGTVDWSLVVQNFDPKRRLFQEIGNCNLVVDSAKSINIRLVNVSGEDIQ
NRDRKLILGVCFTLMHAYTFKLLYEVTQGGRDLPSDDKDILAWVNEQLTEAKARPINSFR
DPAISTGIPILQLLEHIKPNSTNKSIWLEGDSDDFSLCQYAISCCRKAGARVFTLPEHLK
DINGKMILTLFACLQVLYFSLKQKAENKQNRIKTNELKWLKLTDDNKTNGIE
Download sequence
Identical sequences C7TXR1
6182.C7TXR1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]