SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6182.Q5D9S5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6182.Q5D9S5
Domain Number 1 Region: 33-121
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.75e-29
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6182.Q5D9S5
Sequence length 137
Comment (Schistosoma japonicum)
Sequence
MVSAIGNAGSRSNLYHYGTYGNRVDDDTLHSVSEEEQVGFSSWIEKNLIDDPECKRYLPF
QSDGSDLYDKCKDGIILCKIINCSIPNTIDHRAINRHLPLTTYQMHENITLALNSARAIG
CNGVKLEQVIYGMVLNT
Download sequence
Identical sequences Q5D9S5
6182.Q5D9S5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]