SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6182.Q5DAZ2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6182.Q5DAZ2
Domain Number 1 Region: 92-231,279-317
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.22e-17
Family Calponin-homology domain, CH-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6182.Q5DAZ2
Sequence length 360
Comment (Schistosoma japonicum)
Sequence
MPQSGNLQSPGTPRRGVGVGPSYFGNGIYGPNVGGSNDSRESGFLAKLNTLSRSRRRKQE
AEELAAEARQAMEDPLLPAPIDLGIDGCQLAEGEERSMIEPQSKEHPLVQDLSSSLIEWI
NTELLDDRILVRNLEDDLFDGQVLQKLIEKLLSIKINHPEVAQTEIGQKQRLKIVLDEIN
AALGISPLRAAQLWPTSAVYERDLVAILRLLVALVHKFAPTIILPRKVQLTVLIVRKING
ILQHRRQIEPVTDVGDEQDNTEIDHDGISALVDCAIPEQLASFQQTLKTFVNRHLNKLNL
HVTNLETEMSDGVYFIYCLVYLVITLFRYTLIILHRQQMLKSWQIFKSLFNWLMMLKVLI
Download sequence
Identical sequences Q5DAZ2
6182.Q5DAZ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]