SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6182.Q5DGD3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6182.Q5DGD3
Domain Number 1 Region: 24-107
Classification Level Classification E-value
Superfamily HMG-box 6.94e-23
Family HMG-box 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6182.Q5DGD3
Sequence length 135
Comment (Schistosoma japonicum)
Sequence
MEAKSYYFQSPHSSGPFQSIRMNSKSDMRVPKPPKPPEKPLMPYMRYSRKVWEQVKNSNP
HLKLWEVGKIIGQMWRELPDDEKILYVEEYDAEKTQYTELLRQYHSSPAYQAWLVAKERA
EKSLKNKIKSADNRF
Download sequence
Identical sequences Q5DGD3
6182.Q5DGD3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]