SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6238.CBG03064 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG03064
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-37
Family Calponin-homology domain, CH-domain 0.0000145
Further Details:      
 
Domain Number 2 Region: 213-276
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.000000000131
Family EB1 dimerisation domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG03064
Sequence length 306
Comment (Caenorhabditis briggsae)
Sequence
MVVNVFISAVTTDTLSRKEAVAWVNNLLKSHFTKVEEMASGAAYCQLTHLLFANSINLRK
VKFNPRSEPDILTNWKVLTTAWKDLGIDKPVDVEKMKKAKFQDNMEFLQWFYKFFNANLV
GDAEDYDAVGARFNEDLPALKGSSGARPAVAAVRPTAAPVAKPKAVAPAAAPNAAAKASV
APTVRNGTRPAPATSAGTRRSEPSQNEELLKQEIEKQKSLATDWETMAKEMESEREFYYS
MLQRVEGLVHEAEELKSTTIDVEALKAVLYQSNEEGEHEVEATENGADSSQLRDALQANL
DDTDTF
Download sequence
Identical sequences A8WSV6
6238.CBG03064 CBG03064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]